PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla004460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NF-YB
Protein Properties Length: 175aa    MW: 18844.9 Da    PI: 5.7344
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla004460genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1771.8e-5519114297
      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                re+dr+lPianv+rimkk+lP+nakiskdaketvqecvsefisfvt+easdkc++ekrktingddllwa+atlGfedyv+plk++l+++re+ege+
  Cla004460  19 REHDRLLPIANVGRIMKKALPGNAKISKDAKETVQECVSEFISFVTGEASDKCHNEKRKTINGDDLLWAMATLGFEDYVDPLKLHLQRFREIEGER 114
                799*******************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.2E-5114126IPR009072Histone-fold
SuperFamilySSF471137.27E-3922123IPR009072Histone-fold
PfamPF008087.3E-282488IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.2E-205270No hitNo description
PROSITE patternPS0068505571IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.2E-207189No hitNo description
PRINTSPR006154.2E-2090108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MADSDNDSGG GYQKSPSPRE HDRLLPIANV GRIMKKALPG NAKISKDAKE TVQECVSEFI  60
SFVTGEASDK CHNEKRKTIN GDDLLWAMAT LGFEDYVDPL KLHLQRFREI EGERTTLASR  120
DSASAANPAG ATNSTFFDGG GEFGGGMGMS MPPNVYGSNG PRWDGPGFTT TGRPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B3e-4717109294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A3e-4717109294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818601e-150LN681860.1 Cucumis melo genomic scaffold, anchoredscaffold00021.
GenBankLN7132601e-150LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004148262.13e-97PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233108e-67NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A0A0L4U44e-97A0A0A0L4U4_CUCSA; Uncharacterized protein
STRINGGLYMA18G08620.17e-69(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-67nuclear factor Y, subunit B3